PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00129389001
Common NameGSBRNA2T00129389001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 243aa    MW: 26801.5 Da    PI: 6.5628
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00129389001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.5e-372379662
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++ +
  GSBRNA2T00129389001 23 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 79
                         58***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-251977IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.632377IPR003851Zinc finger, Dof-type
PfamPF027011.4E-312477IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MERTEALTSS FIWRPNANAE ITPSCPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG  60
GSLRNVPVGG GCRKSRRPKS SSGNTKTGLT ANSYNSGGGS PNIDLALVYA NFLNPKPDEH  120
KRQENCDTDF LVDDPAGASM EPLWRDIGHG HHHHHYEHQV EHIVEECGYN GLPPFPGEEL  180
LSIDTSGVWS DALLNGHNHV DVGGVTPAQI VQDPVVHFAY ESNDSTNLLF GSWSPFHFSV  240
DG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.109581e-128microspore-derived embryo
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00129389001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115944.11e-170PREDICTED: dof zinc finger protein DOF3.5-like
SwissprotQ9SVC51e-146DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A078CMJ00.0A0A078CMJ0_BRANA; BnaA09g32900D protein
STRINGBra006923.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-135Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]